SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015220295.1.72445 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015220295.1.72445
Domain Number 1 Region: 14-95
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000194
Family Second domain of FERM 0.01
Further Details:      
 
Weak hits

Sequence:  WP_015220295.1.72445
Domain Number - Region: 102-142
Classification Level Classification E-value
Superfamily Chemosensory protein Csp2 0.0051
Family Chemosensory protein Csp2 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015220295.1.72445
Sequence length 145
Comment hypothetical protein [Cyanobacterium aponinum]; AA=GCF_000317675.1; RF=representative genome; TAX=755178; STAX=379064; NAME=Cyanobacterium aponinum PCC 10605; strain=PCC 10605; AL=Complete Genome; RT=Major
Sequence
MDLFTIGFTQTSAEEFFESLKKNHIKTLIDVRLNNSSQLAGYAKKNDLKYFLKALCDIHY
VHILDLAPTKEMLDQFKKQKNMSWIEYEQSYLNLIDNRKIEKKLSPELFENGCLLCSEKK
PHHCHRRVLAEYLNEKWGDIRIKHL
Download sequence
Identical sequences K9Z753
WP_015220295.1.72445 gi|428770826|ref|YP_007162616.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]