SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015407090.1.89941 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_015407090.1.89941
Domain Number - Region: 88-135
Classification Level Classification E-value
Superfamily VSV matrix protein 0.00196
Family VSV matrix protein 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015407090.1.89941
Sequence length 140
Comment hypothetical protein [Dehalococcoides mccartyi]; AA=GCF_001610775.1; RF=na; TAX=61435; STAX=61435; NAME=Dehalococcoides mccartyi; strain=11a5; AL=Complete Genome; RT=Major
Sequence
MKSNNVSSPRLQGIYEQYYRAKRLLQLARRSKKPHTKFTNLIAAVYPARSIVELILEATE
KQELKSPKSNDIKENRKNLELEISQAIPFYHLLEKIRIHDFHRFGCLPPTKNKRRFYGGP
VKLIANQGVVALLITRNGLK
Download sequence
Identical sequences A0A142VA86
gi|452203771|ref|YP_007483904.1| WP_015407090.1.48192 WP_015407090.1.62194 WP_015407090.1.74482 WP_015407090.1.75083 WP_015407090.1.79047 WP_015407090.1.89941 WP_015407090.1.91135 WP_015407090.1.92458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]