SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_016373428.1.66157 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_016373428.1.66157
Domain Number - Region: 56-83
Classification Level Classification E-value
Superfamily Trimerization domain of TRAF 0.034
Family Trimerization domain of TRAF 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_016373428.1.66157
Sequence length 96
Comment MULTISPECIES: hypothetical protein [Lactobacillus]; AA=GCF_000409835.1; RF=na; TAX=1256230; STAX=1597; NAME=Lactobacillus paracasei subsp. tolerans Lpl7; strain=Lpl7; AL=Contig; RT=Major
Sequence
MTFFGYTIGDWAEFISIIGVGVSAGSWLFKKIALDPLRSDIQILSETINRQLKMHEQSLA
DLNTHLKAHDEELGSHSVRITRLEDHVGIKGDNDDE
Download sequence
Identical sequences S2U488
WP_016373428.1.39501 WP_016373428.1.42644 WP_016373428.1.4294 WP_016373428.1.48252 WP_016373428.1.52467 WP_016373428.1.66157 WP_016373428.1.68137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]