SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_016518877.1.97341 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_016518877.1.97341
Domain Number - Region: 43-89
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 0.0523
Family P-domain of calnexin/calreticulin 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_016518877.1.97341
Sequence length 109
Comment hypothetical protein [Treponema vincentii]; AA=GCF_000412995.1; RF=representative genome; TAX=1125702; STAX=69710; NAME=Treponema vincentii F0403; strain=F0403; AL=Scaffold; RT=Major
Sequence
MNKNTIGKLILIGIRYYNNNNELLEQYQTSGIIESITEKEIKIKRENYKELFTIPNDDRA
IIEAKPGDYRERQSGKVIKNPDYISQWTVTGNGSKENIDNYKEKGFELK
Download sequence
Identical sequences S3L8X2
WP_016518877.1.97341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]