SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_016574274.1.33444 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_016574274.1.33444
Domain Number - Region: 60-107
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0217
Family Tachycitin 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_016574274.1.33444
Sequence length 225
Comment MULTISPECIES: hypothetical protein [Streptomyces]; AA=GCF_000403765.2; RF=na; TAX=1316445; STAX=68570; NAME=Streptomyces albulus CCRC 11814; strain=CCRC 11814; AL=Contig; RT=Major
Sequence
MTRIARWATTAAAVAAALGSFAAPAYADVVQPGTPDGPTREVLTAGCASGEDAATVAPTV
VDADSAASFYRCDPVTHRVAAQDGHATCAPGGLFDWNRGLCEPAATVPEMATRLTAGKAT
LSTKPLKVIGLHATLVRARAAGPQDAIWNATITFKDTTGKVLCVAKTDVAGRASCDADRP
RSGAEVLSGGYTAEYAGNGAVNGGYDTVARATAQGGIRAVLPPQV
Download sequence
Identical sequences A0A059WAM9 X0MNE7
WP_016574274.1.11189 WP_016574274.1.1222 WP_016574274.1.32176 WP_016574274.1.33444 WP_016574274.1.60932 WP_016574274.1.85733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]