SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_019226236.1.83799 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_019226236.1.83799
Domain Number - Region: 33-114
Classification Level Classification E-value
Superfamily TIMP-like 0.0746
Family The laminin-binding domain of agrin 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_019226236.1.83799
Sequence length 227
Comment MULTISPECIES: hypothetical protein [Dehalobacter]; AA=GCF_000309295.1; RF=na; TAX=304767; STAX=304767; NAME=Dehalobacter sp. E1; strain=E1; AL=Contig; RT=Major
Sequence
MKRSIVILLVGLFLLAGVLAKEANASWAALSTEEIIEKSDVVLIGEIIGPDREEKISTKG
LPDSWATHWKVKVYYYLKGNQKAEVFTVTTPGAKNKSPQSSIDYRLDQFGKTVLIFLQNR
EGIFEPLSPQGIVVLKVNYYSPKQGEQINGQTVLNEFTIVNPQINDRSILEKYISDNQTI
LIPEHGMSDSYSNSGNSNKLKIITIVILIIALISTGSWFIVKQFQKG
Download sequence
Identical sequences A0A1C2XXZ4
WP_019226236.1.48873 WP_019226236.1.83799 WP_019226236.1.89380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]