SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_019331239.1.87724 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_019331239.1.87724
Domain Number - Region: 31-60
Classification Level Classification E-value
Superfamily Orange domain-like 0.00105
Family Hairy Orange domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_019331239.1.87724
Sequence length 96
Comment MULTISPECIES: hypothetical protein [Pseudomonas syringae group]; AA=GCF_001401405.1; RF=na; TAX=251704; STAX=251701; NAME=Pseudomonas syringae pv. berberidis; strain=ICMP4116; AL=Scaffold; RT=Major
Sequence
MTDHKRKGGMSFGELLAGGMKPGADLGPAYDRDHESSYRRGYHHCAVDIARFIDQNGPIT
PELLQEWINGAAIHWRKSVTRERKIMAPAFLPDDQR
Download sequence
Identical sequences A0A0N8T4X1 A0A0P9KWI9 A0A0Q0BGG6 A0A0Q0E5Y4 A0A2G4CK02 A0A2K4X458
WP_019331239.1.18673 WP_019331239.1.25462 WP_019331239.1.28366 WP_019331239.1.2893 WP_019331239.1.41549 WP_019331239.1.50828 WP_019331239.1.71486 WP_019331239.1.79959 WP_019331239.1.87092 WP_019331239.1.87724 WP_019331239.1.87869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]