SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_020834874.1.64038 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_020834874.1.64038
Domain Number - Region: 28-69
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0129
Family PB1 domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_020834874.1.64038
Sequence length 81
Comment hypothetical protein [Vibrio parahaemolyticus]; AA=GCF_001727725.1; RF=na; TAX=670; STAX=670; NAME=Vibrio parahaemolyticus; strain=CDC_K4557; AL=Contig; RT=Major
Sequence
MRNHPKIVNLSSTSTTPEREAMKVLIQYTQAGKYRDQAWESLTLRSKGDMQAVTPSYAAQ
LIEQSKATLVMTEDGQIIFHS
Download sequence
Identical sequences A0A2J0ZF01
WP_020834874.1.11219 WP_020834874.1.12691 WP_020834874.1.15831 WP_020834874.1.19647 WP_020834874.1.22207 WP_020834874.1.27116 WP_020834874.1.34806 WP_020834874.1.35739 WP_020834874.1.38922 WP_020834874.1.42185 WP_020834874.1.42393 WP_020834874.1.45334 WP_020834874.1.45873 WP_020834874.1.48684 WP_020834874.1.50654 WP_020834874.1.58214 WP_020834874.1.63813 WP_020834874.1.64038 WP_020834874.1.71308 WP_020834874.1.73171 WP_020834874.1.76704 WP_020834874.1.90465 WP_020834874.1.92867

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]