SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_021359157.1.36257 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_021359157.1.36257
Domain Number - Region: 42-80
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 0.0915
Family P-domain of calnexin/calreticulin 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_021359157.1.36257
Sequence length 81
Comment hypothetical protein [Clostridioides difficile]; AA=GCF_900165625.1; RF=na; TAX=1496; STAX=1496; NAME=Clostridioides difficile; strain=VRECD0033; AL=Contig; RT=Major
Sequence
MKRIKKVFRDLVENYKEEKFEKQEAIEMQEAIEAIRQEIGRHDPTINTPKDSAGNVGDEP
PFISNPLVANQPIKNPKYKGN
Download sequence
Identical sequences A0A1R4N2J3
WP_021359157.1.100831 WP_021359157.1.15192 WP_021359157.1.19648 WP_021359157.1.293 WP_021359157.1.31719 WP_021359157.1.36257 WP_021359157.1.45209 WP_021359157.1.48980 WP_021359157.1.49230 WP_021359157.1.52330 WP_021359157.1.52402 WP_021359157.1.63804 WP_021359157.1.78949 WP_021359157.1.83918 WP_021359157.1.85020 WP_021359157.1.89364 WP_021359157.1.97672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]