SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_021370868.1.26494 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_021370868.1.26494
Domain Number - Region: 59-95
Classification Level Classification E-value
Superfamily Ribosomal protein L29 (L29p) 0.0183
Family Ribosomal protein L29 (L29p) 0.015
Further Details:      
 
Domain Number - Region: 4-63
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 0.0759
Family Transducin (alpha subunit), insertion domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_021370868.1.26494
Sequence length 111
Comment MULTISPECIES: flagellar protein FliT [Clostridiales]; AA=GCF_000632735.1; RF=na; TAX=1496; STAX=1496; NAME=Clostridioides difficile; strain=SG12; AL=Scaffold; RT=Major
Sequence
MDKLEEKINLYKDISLKIINFIEKMEYKNISFQLDERQNIINSISEVDKSEFIQLYDSME
LFEIDANIRDALQEQLSEVKKELHEYKLTKQVNTMYYSSNREKVNIFNKKV
Download sequence
Identical sequences WP_021370868.1.18970 WP_021370868.1.22568 WP_021370868.1.23096 WP_021370868.1.24987 WP_021370868.1.26494 WP_021370868.1.29757 WP_021370868.1.32218 WP_021370868.1.3340 WP_021370868.1.38924 WP_021370868.1.4315 WP_021370868.1.43388 WP_021370868.1.53008 WP_021370868.1.62941 WP_021370868.1.65064 WP_021370868.1.66439 WP_021370868.1.67303 WP_021370868.1.67951 WP_021370868.1.713 WP_021370868.1.76793 WP_021370868.1.89052 WP_021370868.1.89457 WP_021370868.1.93480

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]