SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_021518667.1.15538 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_021518667.1.15538
Domain Number - Region: 3-93
Classification Level Classification E-value
Superfamily P40 nucleoprotein 0.0837
Family P40 nucleoprotein 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_021518667.1.15538
Sequence length 190
Comment hypothetical protein [Escherichia coli]; AA=GCF_000597845.1; RF=na; TAX=562; STAX=562; NAME=Escherichia coli; strain=ST540; AL=Complete Genome; RT=Major
Sequence
MKIDKKLNLVTSVTRDDGSIVYLHVTPFPYEVVEEHCILLGNLFTKFISQVGGLGAARIA
AMMLRQSLKAEIDNGRAGPNIVDEIQRLTVVIHNVGGQWKTTPLEVAFNQGIIDPDEYRE
IEGEVVFFMVSSAIQKANLIAPTVGTVIKMYDGQLTSSSVTAFRDSLQTSKPVTDTQTQN
AQPETSFIPS
Download sequence
Identical sequences A0A1X7AWQ2
WP_021518667.1.15538 WP_021518667.1.1755 WP_021518667.1.20596 WP_021518667.1.27175 WP_021518667.1.41417 WP_021518667.1.52852 WP_021518667.1.53545 WP_021518667.1.64926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]