SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_022714221.1.80625 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_022714221.1.80625
Domain Number 1 Region: 40-87
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000442
Family Ovomucoid domain III-like 0.015
Further Details:      
 
Domain Number 2 Region: 123-162
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000513
Family Ovomucoid domain III-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_022714221.1.80625
Sequence length 163
Comment membrane protein [Rhizobium mongolense]; AA=GCF_000419765.1; RF=na; TAX=1079460; STAX=57676; NAME=Rhizobium mongolense USDA 1844; strain=USDA 1844; AL=Contig; RT=Major
Sequence
MTAINTKCSLGSKRFALLALIPLLSACTVEVDPGPSRPPPSPWPPQQQMCTMEYAPVCGE
RGGRLQTFGNACQARNSGFMIVGRGECRRAPPPFARPDRDRPGRPDWPDRPDRPDRPERP
GGICTREYAPVCGQRGRQTQTFPNPCEAGNAGFRIISGGECRF
Download sequence
Identical sequences WP_022714221.1.80625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]