SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_022786626.1.44212 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_022786626.1.44212
Domain Number 1 Region: 15-204
Classification Level Classification E-value
Superfamily Archaeal IMP cyclohydrolase PurO 4.58e-24
Family Archaeal IMP cyclohydrolase PurO 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_022786626.1.44212
Sequence length 235
Comment inosine monophosphate cyclohydrolase [Clostridiales bacterium NK3B98]; AA=GCF_000421005.1; RF=na; TAX=877414; STAX=877414; NAME=Clostridiales bacterium NK3B98; strain=NK3B98; AL=Contig; RT=Major
Sequence
MELLNLAQELQSNPYPGRGIVLGRSADGKSAVIAYFIMGRSENSRNRIFSVTDDGIRTEA
FDPSKMVDPSLIIYHPVRKVGNKTVVTNGDQTDTIMDALNAGHCYRHALMQRTFEPDGPN
YTPRISGVMLPNGAYKLSILKSFEGNPDFCNRYFYEYEGAPAGWGHFIHTYMGDGNPLPS
FQGEPELVGIPCDSASDFAKLLWDNLNEENKVSLFVRYIDLATQETDDVIVNKHQ
Download sequence
Identical sequences WP_022786626.1.44212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]