SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_023114363.1.30614 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_023114363.1.30614
Domain Number 1 Region: 6-129
Classification Level Classification E-value
Superfamily PA2201 N-terminal domain-like 4.71e-61
Family PA2201 N-terminal domain-like 0.00000025
Further Details:      
 
Domain Number 2 Region: 137-291
Classification Level Classification E-value
Superfamily PA2201 C-terminal domain-like 3.92e-44
Family PA2201 C-terminal domain-like 0.0000000358
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_023114363.1.30614
Sequence length 294
Comment MULTISPECIES: hypothetical protein [Pseudomonas]; AA=GCF_001750705.1; RF=na; TAX=287; STAX=287; NAME=Pseudomonas aeruginosa; strain=FA-HZ1; AL=Complete Genome; RT=Major
Sequence
MHAFPLTLDNRLAEALPLWRNLARTDRAPRRNIDLADWKADWRELIAALDRFSRSHGYRQ
PFAAQGHAALENAWAWGQAAENASTLLLKAIDRGLAGAELRSIYLETAALWLDYSRLLGA
ARDSLREQGEVDFETAPALAPRTGQYPFALQLLAMGVLLDAQELIPALVEEVLQFDTDRL
LDYLGAAALGLTSASEETFHPRPFGQLRAFFEEADGSDAQALAPYLQSQYREFFQLSPKA
QKKTRRLTGPYAWGWWAMEVSALGVLYGWDDGVLRASPHYLGDLVDYARERGDA
Download sequence
Identical sequences WP_023114363.1.10185 WP_023114363.1.10529 WP_023114363.1.12687 WP_023114363.1.13529 WP_023114363.1.14424 WP_023114363.1.152 WP_023114363.1.16239 WP_023114363.1.17370 WP_023114363.1.21358 WP_023114363.1.29179 WP_023114363.1.29577 WP_023114363.1.29848 WP_023114363.1.30614 WP_023114363.1.42917 WP_023114363.1.4398 WP_023114363.1.44213 WP_023114363.1.45228 WP_023114363.1.49360 WP_023114363.1.50180 WP_023114363.1.51889 WP_023114363.1.5260 WP_023114363.1.54133 WP_023114363.1.56632 WP_023114363.1.61549 WP_023114363.1.62716 WP_023114363.1.66165 WP_023114363.1.68317 WP_023114363.1.68638 WP_023114363.1.73860 WP_023114363.1.75935 WP_023114363.1.78795 WP_023114363.1.81834 WP_023114363.1.82328 WP_023114363.1.82604 WP_023114363.1.84003 WP_023114363.1.8484 WP_023114363.1.86652 WP_023114363.1.90224 WP_023114363.1.9191 WP_023114363.1.93144 WP_023114363.1.93498 WP_023114363.1.94814 WP_023114363.1.96506 WP_023114363.1.98260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]