SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_023283318.1.94860 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_023283318.1.94860
Domain Number - Region: 28-64
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 0.0222
Family Supernatant protein factor (SPF), C-terminal domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_023283318.1.94860
Sequence length 66
Comment hypothetical protein [Klebsiella pneumoniae]; AA=GCF_001032775.1; RF=na; TAX=573; STAX=573; NAME=Klebsiella pneumoniae; strain=CHS201; AL=Scaffold; RT=Major
Sequence
MSKYPRVGSVAAKSKNTSAKCKCGAVAKFKTTVEVNVFRGDDEVVWSCNEHKKDCSFLVD
WQGGAA
Download sequence
Identical sequences WP_023283318.1.14580 WP_023283318.1.87767 WP_023283318.1.94701 WP_023283318.1.94860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]