SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_023340284.1.69745 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_023340284.1.69745
Domain Number - Region: 160-190
Classification Level Classification E-value
Superfamily BRK domain-like 0.0994
Family BRK domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_023340284.1.69745
Sequence length 217
Comment MULTISPECIES: LysE family translocator [Klebsiella]; AA=GCF_000493095.1; RF=na; TAX=244366; STAX=244366; NAME=Klebsiella variicola; strain=MGH 20; AL=Scaffold; RT=Major
Sequence
MPSIETFITFLLALTLLEISPGPDMMLTIARGVGQGRRIALLTVLGNVFVAGFVQVSFLV
LGLVTVVHAWPVALDLLRCVGAAYLMWLGVKMIATSGTDTRLRKTAKISDWSAVKEGALN
SLTNPKSLLFMFAFLPQFVDPAAGPVWLQLLVLGSIQKLAGIISLGSVAMASGTFGNWLS
KHPGFIKWQERFTGVVMIGLGIRMLFSGSGVVSKPSS
Download sequence
Identical sequences WP_023340284.1.35820 WP_023340284.1.69745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]