SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_023401096.1.99810 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_023401096.1.99810
Domain Number - Region: 62-117
Classification Level Classification E-value
Superfamily TIMP-like 0.0785
Family Netrin-like domain (NTR/C345C module) 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_023401096.1.99810
Sequence length 140
Comment hypothetical protein [Pseudoalteromonas luteoviolacea]; AA=GCF_001625565.1; RF=na; TAX=1365254; STAX=43657; NAME=Pseudoalteromonas luteoviolacea NCIMB 1944; strain=NCIMB 1944; AL=Contig; RT=Major
Sequence
MRYFLALLTLLSNMSLACTVESRSYTELVSQAKQVFIGSVVEIHWSDFEKHVRKHSPVEK
EEVIMLKGGGYTYRAIPHKVWKGQLNASLRLRGGYCNGAFVDGGETYLIMTFDDSSELGS
KTFPLNPELIKIVKAELSSN
Download sequence
Identical sequences V4HU98
WP_023401096.1.60081 WP_023401096.1.99810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]