SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_023559403.1.69190 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_023559403.1.69190
Domain Number - Region: 21-72
Classification Level Classification E-value
Superfamily VPS9 domain 0.0981
Family VPS9 domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_023559403.1.69190
Sequence length 77
Comment hypothetical protein [Listeria monocytogenes]; AA=GCF_000960145.1; RF=na; TAX=1639; STAX=1639; NAME=Listeria monocytogenes; strain=14KSM; AL=Contig; RT=Major
Sequence
MFFKWGFISFLMGLCSFFIFFIVNIFRQIMVATASGVDGYSTYVSNFDVMLPALIFPVIL
TFFIPLVIYFTYLFKKK
Download sequence
Identical sequences WP_023559403.1.12988 WP_023559403.1.155 WP_023559403.1.28042 WP_023559403.1.31691 WP_023559403.1.35135 WP_023559403.1.39630 WP_023559403.1.45524 WP_023559403.1.45811 WP_023559403.1.47384 WP_023559403.1.47593 WP_023559403.1.49415 WP_023559403.1.49668 WP_023559403.1.49708 WP_023559403.1.5170 WP_023559403.1.55824 WP_023559403.1.55890 WP_023559403.1.57578 WP_023559403.1.57948 WP_023559403.1.60295 WP_023559403.1.6672 WP_023559403.1.6731 WP_023559403.1.67668 WP_023559403.1.69190 WP_023559403.1.84367 WP_023559403.1.92370 WP_023559403.1.93997 WP_023559403.1.95715 WP_023559403.1.97752 WP_023559403.1.98351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]