SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_023820006.1.58072 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_023820006.1.58072
Domain Number - Region: 28-77
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 0.0034
Family eIF-2-alpha, C-terminal domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_023820006.1.58072
Sequence length 135
Comment hypothetical protein [Mesorhizobium sp. L2C066B000]; AA=GCF_000502335.1; RF=na; TAX=1287105; STAX=1287105; NAME=Mesorhizobium sp. L2C066B000; strain=L2C066B000; AL=Contig; RT=Major
Sequence
MATKRVPPTPIDADATIASMVPGLDKPVEYVRRVLEKLERCKRAHGDAQVRVSVRGRAEA
PNYLVEYVREDKKTQERVTYQDAAYSGSTHRELAAHHIAEARNWSPEEMNITAVSALIGR
LRNPRAPSSRFSDED
Download sequence
Identical sequences X6HE61
WP_023820006.1.58072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]