SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_023873981.1.87644 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_023873981.1.87644
Domain Number - Region: 47-77
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0222
Family SIAH, seven in absentia homolog 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_023873981.1.87644
Sequence length 90
Comment MULTISPECIES: hypothetical protein [Pandoraea]; AA=GCF_000504585.2; RF=na; TAX=93220; STAX=93220; NAME=Pandoraea pnomenusa; strain=RB-44; AL=Complete Genome; RT=Major
Sequence
MGDIAEMMLDGTLCEGCGVALDGAGEGFPRRCCDCQEESTFDQPKKASKCYCPDCGRRVK
AAGLADHMRDAHQATYFKLEVRYARARGAA
Download sequence
Identical sequences V5UJY7
gi|564914694|ref|YP_008881648.1| WP_023873981.1.32553 WP_023873981.1.87644 WP_023873981.1.99751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]