SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_023906477.1.57220 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_023906477.1.57220
Domain Number - Region: 17-52
Classification Level Classification E-value
Superfamily SOCS box-like 0.0942
Family SOCS box-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_023906477.1.57220
Sequence length 66
Comment hypothetical protein [Xylella fastidiosa]; AA=GCF_001549755.1; RF=na; TAX=2371; STAX=2371; NAME=Xylella fastidiosa; strain=OLS0478; AL=Contig; RT=Major
Sequence
MAAMLLSYVQWMVLMVLFLYVYVRGFQQLCRWICYRLYYAPIGSHLQLPYIIALADLRCR
QDPTTT
Download sequence
Identical sequences A0A1S0VA09
WP_023906477.1.14431 WP_023906477.1.27993 WP_023906477.1.3 WP_023906477.1.3250 WP_023906477.1.4338 WP_023906477.1.45907 WP_023906477.1.57220 WP_023906477.1.58312 WP_023906477.1.64904 WP_023906477.1.72049 WP_023906477.1.82282 WP_023906477.1.82778 WP_023906477.1.92333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]