SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_024052525.1.85432 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_024052525.1.85432
Domain Number - Region: 19-72
Classification Level Classification E-value
Superfamily tRNA-intron endonuclease catalytic domain-like 0.0288
Family tRNA-intron endonuclease catalytic domain-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_024052525.1.85432
Sequence length 90
Comment MULTISPECIES: hypothetical protein [Streptococcus]; AA=GCF_001835965.1; RF=na; TAX=1715209; STAX=1715209; NAME=Streptococcus sp. HMSC034F02; strain=HMSC034F02; AL=Scaffold; RT=Major
Sequence
MRRSEGLKMFFPILTTASYNSDDYINKGAEHFCLSFLLYNGKMPYDGAFHLLFKLKKAPN
TENIVWVSFLRLRRSKLVLVHVVRGSDGAN
Download sequence
Identical sequences A0A1F0RK47 A0A2I1ZF89 W1TT83
WP_024052525.1.24156 WP_024052525.1.43030 WP_024052525.1.43933 WP_024052525.1.76695 WP_024052525.1.82055 WP_024052525.1.85432 WP_024052525.1.86448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]