SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_024125250.1.87165 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_024125250.1.87165
Domain Number 1 Region: 6-221
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 5.34e-56
Family NanE-like 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_024125250.1.87165
Sequence length 228
Comment N-acetylmannosamine-6-phosphate 2-epimerase NanE [Thermosynechococcus sp. NK55a]; AA=GCF_000505665.1; RF=na; TAX=1394889; STAX=1394889; NAME=Thermosynechococcus sp. NK55a; strain=NK55; AL=Chromosome; RT=Major
Sequence
MNLATQIHGGLIVSCQAPPDSPLAAPDIIAAMARAAVLRGAVAVRINTPAHIQAVRQAVN
VPIIGLWKQTLPAYPVYITPRFADAVAVATAGADIIALDATARSRPEPLQDLIQRIHDEL
GKPVMADIDSLENAEAAVAAGADWVGTTLFGYTETTAHTPPPSWSLLSQLVKQLSVPILC
EGGIASPTMAAKALGLGAWAVVVGTDITGIDLKVQRYVAALKANTALS
Download sequence
Identical sequences V5V668
gi|571028254|ref|YP_008900374.1| WP_024125250.1.87165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]