SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_025089183.1.8139 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_025089183.1.8139
Domain Number 1 Region: 33-119
Classification Level Classification E-value
Superfamily TIMP-like 0.0000126
Family Netrin-like domain (NTR/C345C module) 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_025089183.1.8139
Sequence length 174
Comment MULTISPECIES: hypothetical protein [Mycobacterium]; AA=GCF_001216745.1; RF=na; TAX=36809; STAX=36809; NAME=Mycobacterium abscessus; strain=PAP166; AL=Scaffold; RT=Major
Sequence
MTRWTGLMVAAITLTTGGIAASTAVAPNVACACSCVDVRKDSASIKEWLGHAQAIFVGTP
TDTQLISDPETGRTIYQFAVREVYKGDVGPTTTVKVENFGPTCGRSYDIGTEYFVVAGKP
DEIPHDTRPNAPAAYGDNRCSLTQVAAGSDLSGPAQTAYGTPHAPTGPAVTLPG
Download sequence
Identical sequences WP_025089183.1.10195 WP_025089183.1.12298 WP_025089183.1.12515 WP_025089183.1.17740 WP_025089183.1.18002 WP_025089183.1.21315 WP_025089183.1.22456 WP_025089183.1.22913 WP_025089183.1.27499 WP_025089183.1.27979 WP_025089183.1.30285 WP_025089183.1.31072 WP_025089183.1.34166 WP_025089183.1.34987 WP_025089183.1.35375 WP_025089183.1.35745 WP_025089183.1.37704 WP_025089183.1.37873 WP_025089183.1.38570 WP_025089183.1.40102 WP_025089183.1.40144 WP_025089183.1.41715 WP_025089183.1.45069 WP_025089183.1.47233 WP_025089183.1.47597 WP_025089183.1.5339 WP_025089183.1.54790 WP_025089183.1.60315 WP_025089183.1.65605 WP_025089183.1.73460 WP_025089183.1.75662 WP_025089183.1.80108 WP_025089183.1.8139 WP_025089183.1.81797 WP_025089183.1.82256 WP_025089183.1.87974 WP_025089183.1.89015 WP_025089183.1.91669 WP_025089183.1.91819 WP_025089183.1.93931 WP_025089183.1.95283 WP_025089183.1.95436 WP_025089183.1.97945 WP_025089183.1.98298 WP_025089183.1.98437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]