SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_025385031.1.68616 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_025385031.1.68616
Domain Number - Region: 66-125
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.0641
Family SCAN domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_025385031.1.68616
Sequence length 153
Comment hypothetical protein [Legionella oakridgensis]; AA=GCF_000512715.1; RF=na; TAX=1274403; STAX=29423; NAME=Legionella oakridgensis RV-2-2007; strain=RV-2-2007; AL=Contig; RT=Major
Sequence
MKDSLFEMLLSLFEKTLNKLKENHATDGATKETIKENLPDLYTSSLDIASEDLEADFFKS
ARADSMRVFTYDEQMKFTKASYQFLMRLLVWEIIDRDTLELIINQLVFSDSRIVSLEETK
WTVRSVLADTLNTKQLAFLDLVLYQKRDGYSLH
Download sequence
Identical sequences A0A0W0XHB4 W0BC21
WP_025385031.1.6252 WP_025385031.1.68616 WP_025385031.1.90696 WP_025385031.1.93386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]