SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_027170559.1.9482 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_027170559.1.9482
Domain Number 1 Region: 134-192
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000000143
Family Anti-platelet protein 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_027170559.1.9482
Sequence length 289
Comment hypothetical protein [Mesorhizobium sp. WSM3224]; AA=GCF_000427725.1; RF=na; TAX=1040986; STAX=1040986; NAME=Mesorhizobium sp. WSM3224; strain=WSM3224; AL=Scaffold; RT=Major
Sequence
MPSTNNRHANLLSAIGFAALMLWTANLPAGAQSSDTLFDYPETVLNGPISATVNIPLQES
CRRLCSTRSGCIGFDYASAGGICRMFSAVVGAANSNDHTAGTRSLIQNYRQPANPPAPPP
APAPAQEETIVQPPAASFSRFVNRDLTGGSIASTAAGSIDQCEAMCQSTGRSCQAYTYDA
WNRRCFLKSETGQLLLNARAISGVLTGVETPVLSGAPVHMEYFNNKAFSGEGFRVLASPS
REACANECWGAGQCVAFGFTGSQRRCVLFDQPGEYFSSRGTDSGAKRQN
Download sequence
Identical sequences WP_027170559.1.9482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]