SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_027448751.1.87926 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_027448751.1.87926
Domain Number 1 Region: 31-138
Classification Level Classification E-value
Superfamily TIMP-like 2.16e-17
Family Tissue inhibitor of metalloproteinases, TIMP 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_027448751.1.87926
Sequence length 193
Comment hypothetical protein [Pontibacillus marinus]; AA=GCF_000425225.1; RF=representative genome; TAX=1385511; STAX=273164; NAME=Pontibacillus marinus BH030004 = DSM 16465; strain=DSM 16465; AL=Scaffold; RT=Major
Sequence
MKVNGFVKYISLFITMMFLVLSSFSNTSYACSCAEPGTPKEELEKSDAIFSGKVINMHDA
KKNDSIKSSGDPIAVLLEVDRSWKGVDETQVIVYTARASATCGYEFNLNEEYLVYAREVK
GELKVSYCSRTENLLQASEDVIALGGENIELEEVSLEFPPENYIILRLLVITGITVSIVI
IFKRLIRKMRNRS
Download sequence
Identical sequences A0A0A5HQN3
WP_027448751.1.47255 WP_027448751.1.87926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]