SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_028523498.1.16531 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_028523498.1.16531
Domain Number 1 Region: 28-70
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000013
Family Ovomucoid domain III-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_028523498.1.16531
Sequence length 74
Comment protease inhibitor Kazal-type [Runella limosa]; AA=GCF_000482465.1; RF=representative genome; TAX=1123077; STAX=370978; NAME=Runella limosa DSM 17973; strain=DSM 17973; AL=Scaffold; RT=Major
Sequence
MKKSIFVALVLAGLVGCQKEEIASECVEKPNNGMICTMQYDPVCGCNGKTYGNACAAASV
GITNYTKGECGKKD
Download sequence
Identical sequences WP_028523498.1.16531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]