SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_028853015.1.10616 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_028853015.1.10616
Domain Number 1 Region: 70-109
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000107
Family Tachycitin 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_028853015.1.10616
Sequence length 116
Comment chitin-binding protein [Ralstonia solanacearum]; AA=GCF_000348545.1; RF=na; TAX=1262456; STAX=305; NAME=Ralstonia solanacearum FQY_4; strain=FQY_4; AL=Chromosome; RT=Major
Sequence
MTRALTLCALLCALVLTGCERRPSGPPTPQTSQTAQAAGLTRAAAEFKCPAPSGRYLVDD
GTNRGPNQPVRTNCTRAYAVCDAQSHATLDHCPSGQVFDKRFSTCVVKDACDEIPS
Download sequence
Identical sequences A0A0S4UIT3
WP_028853015.1.10616 WP_028853015.1.13792 WP_028853015.1.19504 WP_028853015.1.28416 WP_028853015.1.51566 WP_028853015.1.57025 WP_028853015.1.65509 WP_028853015.1.67790 WP_028853015.1.73188 WP_028853015.1.76782 WP_028853015.1.87978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]