SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_031631979.1.16788 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_031631979.1.16788
Domain Number - Region: 58-117
Classification Level Classification E-value
Superfamily Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain 0.0732
Family Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_031631979.1.16788
Sequence length 120
Comment hypothetical protein [Pseudomonas aeruginosa]; AA=GCF_001765795.1; RF=na; TAX=287; STAX=287; NAME=Pseudomonas aeruginosa; strain=TNCF_85; AL=Contig; RT=Major
Sequence
MTTGRVAAALTALCLLCQPAFGFIKVFPEFDDDPGAATFFWAAVTTVGPFIGSTVSAQES
SADEGDKLVQARDDAASFVASDGAIRGAYLQAALQVLRQAPEYAGYSDLQLAAALLARQP
Download sequence
Identical sequences WP_031631979.1.10202 WP_031631979.1.10228 WP_031631979.1.15004 WP_031631979.1.15934 WP_031631979.1.16788 WP_031631979.1.16801 WP_031631979.1.19711 WP_031631979.1.22389 WP_031631979.1.26682 WP_031631979.1.28920 WP_031631979.1.32637 WP_031631979.1.34670 WP_031631979.1.41412 WP_031631979.1.42946 WP_031631979.1.46010 WP_031631979.1.4699 WP_031631979.1.48576 WP_031631979.1.50814 WP_031631979.1.51035 WP_031631979.1.51273 WP_031631979.1.52043 WP_031631979.1.58838 WP_031631979.1.58845 WP_031631979.1.60062 WP_031631979.1.61122 WP_031631979.1.65009 WP_031631979.1.65337 WP_031631979.1.6629 WP_031631979.1.66371 WP_031631979.1.68541 WP_031631979.1.7308 WP_031631979.1.73490 WP_031631979.1.73791 WP_031631979.1.74182 WP_031631979.1.74958 WP_031631979.1.75119 WP_031631979.1.77238 WP_031631979.1.80087 WP_031631979.1.81081 WP_031631979.1.81816 WP_031631979.1.86813 WP_031631979.1.95745 WP_031631979.1.95751 WP_031631979.1.98672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]