SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_032005463.1.100046 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_032005463.1.100046
Domain Number - Region: 42-97
Classification Level Classification E-value
Superfamily Bromodomain 0.000602
Family Bromodomain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_032005463.1.100046
Sequence length 103
Comment MULTISPECIES: hypothetical protein [Acinetobacter calcoaceticus/baumannii complex]; AA=GCF_002138235.1; RF=na; TAX=48296; STAX=48296; NAME=Acinetobacter pittii; strain=PR393; AL=Contig; RT=Major
Sequence
MEKVFLEDDLPVAIEINRNKKKIKCVKFVISDLTALEYVEAQSKISGLQYVSISDVVAMV
KLIDSNGIQYEPTYDEIAQTTQFNLTHFFNKKAELEAKVKAAN
Download sequence
Identical sequences A0A1H8TLC5
WP_032005463.1.100046 WP_032005463.1.1554 WP_032005463.1.17533 WP_032005463.1.21609 WP_032005463.1.46249 WP_032005463.1.48736 WP_032005463.1.52219 WP_032005463.1.56855 WP_032005463.1.58887 WP_032005463.1.59778 WP_032005463.1.87895 WP_032005463.1.90911 WP_032005463.1.95194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]