SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_032660314.1.55705 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_032660314.1.55705
Domain Number - Region: 50-97
Classification Level Classification E-value
Superfamily BRCA2 tower domain 0.0863
Family BRCA2 tower domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_032660314.1.55705
Sequence length 141
Comment MULTISPECIES: hypothetical protein [Enterobacter cloacae complex]; AA=GCF_000534455.1; RF=na; TAX=1329846; STAX=550; NAME=Enterobacter cloacae BIDMC 8; strain=BIDMC 8; AL=Scaffold; RT=Major
Sequence
MNDDSGNNVYLTLDDKKSDEFILKQNLDALKKIKNDEMTRITQDLVSIPATLVRLKWQNR
REIYSLQAKEEIYGAVMNAIIEQRPELKEKILGRLEANYQYLLARETATLRLTRKLSEGN
YRTSNVTCVALDEEAPTAPSE
Download sequence
Identical sequences A0A2J0QZW6
WP_032660314.1.19666 WP_032660314.1.29371 WP_032660314.1.35190 WP_032660314.1.36152 WP_032660314.1.40432 WP_032660314.1.4113 WP_032660314.1.54267 WP_032660314.1.55705 WP_032660314.1.5823 WP_032660314.1.74224 WP_032660314.1.91228 WP_032660314.1.91599 WP_032660314.1.96919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]