SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_034256730.1.16841 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_034256730.1.16841
Domain Number 1 Region: 22-76
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000111
Family Ovomucoid domain III-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_034256730.1.16841
Sequence length 80
Comment hypothetical protein [Adhaeribacter aquaticus]; AA=GCF_000473365.1; RF=representative genome; TAX=926549; STAX=299567; NAME=Adhaeribacter aquaticus DSM 16391; strain=DSM 16391; AL=Scaffold; RT=Major
Sequence
MILKSYLGFASILGILITVFSFCKIPKSSCIDPNKIDKEALCTMQYEPVCGCDNKTYENA
CFAERAGVVSYTPGACKATP
Download sequence
Identical sequences WP_034256730.1.16841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]