SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_036080896.1.47240 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_036080896.1.47240
Domain Number - Region: 58-168
Classification Level Classification E-value
Superfamily TIMP-like 0.0824
Family Tissue inhibitor of metalloproteinases, TIMP 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_036080896.1.47240
Sequence length 223
Comment hypothetical protein [Listeria cornellensis]; AA=GCF_000525855.1; RF=na; TAX=1265820; STAX=1494961; NAME=Listeria cornellensis FSL F6-0969; strain=FSL F6-0969; AL=Contig; RT=Major
Sequence
MKKSAIVKIMSITLIIAIGVFFLTINGNNDKAAQKDEAKKDKIPVYDMRSTYTLDIDNPK
EVVGSADYVFVGKVLEETGTVYRNKVPVEVDSDTIEYIGDAYTQYKIQVISNIKNELVTD
NVIDIDKLGGIREDGSAYDVFEDDELPVQGETYIFTAYTQDDGSLLISGANSNIRFDENA
SKVSTEKAVSTTEEYQEYQDAVDDQIEPEGKEDLKSIYDATEE
Download sequence
Identical sequences W7BII3
WP_036080896.1.47240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]