SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_036401735.1.88161 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_036401735.1.88161
Domain Number - Region: 119-209
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.0478
Family alpha-1,3-galactosyltransferase-like 0.085
Further Details:      
 
Domain Number - Region: 54-78
Classification Level Classification E-value
Superfamily P40 nucleoprotein 0.0549
Family P40 nucleoprotein 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_036401735.1.88161
Sequence length 314
Comment hypothetical protein [Microcystis aeruginosa]; AA=GCF_000332585.1; RF=na; TAX=1235808; STAX=1126; NAME=Microcystis aeruginosa DIANCHI905; strain=DIANCHI905; AL=Contig; RT=Major
Sequence
MASPTCSLWFFVARTDLPFMMLTIPHIVKMCNFPFQEKVLAIDTAALSGEKVDRPGIGTM
EDLRQCAQTLLHKGVVDRIVDFNYDSRYQERLYLKHFGSAIKPTHNYKGYPILGSIFKIE
ECQSDYLLHFDSDMMMYQEPGYKWIAEGIDLMEANPRIMFVRPMTGPPTSDGKFCESDTG
KLNPQGFYEFKYFGSRLYLLKCNRFDELLPLPIIWYNEYRQQFVKNWPEGMKTALNIWTG
KGKLDSWEIMVSEKLKQTDYLRINLTNPRAWSLHPKERSPAFIAALPSIIARIERGDFPA
KQAGFYDLIFDLWV
Download sequence
Identical sequences A8YGM1
WP_036401735.1.62741 WP_036401735.1.88161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]