SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_039564214.1.34799 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_039564214.1.34799
Domain Number 1 Region: 70-109
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.00000706
Family Tachycitin 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_039564214.1.34799
Sequence length 116
Comment chitin-binding protein [Ralstonia solanacearum]; AA=GCF_000750585.1; RF=na; TAX=305; STAX=305; NAME=Ralstonia solanacearum; strain=POPS2; AL=Contig; RT=Major
Sequence
MTRALTLCTLLCALALTGCERRPSAPPTPQTSQTAQAAELARAAADFKCPAPSGRYLVDD
GTNRGPNQPVRTNCTRAYAICDAQSHATLDHCPSGQVFDKRFSMCVVKDACDEVAP
Download sequence
Identical sequences WP_039564214.1.12624 WP_039564214.1.34799 WP_039564214.1.86062 WP_039564214.1.92146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]