SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_041068480.1.58659 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_041068480.1.58659
Domain Number - Region: 55-140
Classification Level Classification E-value
Superfamily VPS9 domain 0.00275
Family VPS9 domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_041068480.1.58659
Sequence length 148
Comment hypothetical protein [Thiolapillus brandeum]; AA=GCF_000828615.1; RF=representative genome; TAX=1076588; STAX=1076588; NAME=Thiolapillus brandeum; strain=Hiromi 1; AL=Complete Genome; RT=Major
Sequence
MLSYDELHAQNDHITELTNTLRLLLTDRLLCDSHITAELFCRYVDAVKEHLEITDKKLYT
QMLTSADQQVTTVANRFMGGSKEIKRIFNDFVKKWCNMKKQQLMVADYEEFARITDGMFD
MVLDRIQDEVEHLYPMLRKVRGDDKYAA
Download sequence
Identical sequences W0TQ43
WP_041068480.1.58659

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]