SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_042293717.1.59893 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_042293717.1.59893
Domain Number 1 Region: 20-109
Classification Level Classification E-value
Superfamily TIMP-like 0.000034
Family Tissue inhibitor of metalloproteinases, TIMP 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_042293717.1.59893
Sequence length 162
Comment hypothetical protein [Nonlabens ulvanivorans]; AA=GCF_000755265.1; RF=na; TAX=906888; STAX=906888; NAME=Nonlabens ulvanivorans; strain=JCM 19297; AL=Contig; RT=Major
Sequence
MNYYKLILLFLVWPFVSDYCTCPPPKHWEKAASMEFEYSEVVFVGDVKSFSNDKNKLIIE
VCEVFKGDLKSGQIILGKNLRSCYPYIDRGGSWLLFGNHSKIFEVNECGISSNIEMPRQL
MIPIKPPSVITENRRIQEKTQREKDAKEAMQNLLTQLRNIVP
Download sequence
Identical sequences WP_042293717.1.59893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]