SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_043995579.1.77316 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_043995579.1.77316
Domain Number 1 Region: 14-159
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.84e-17
Family Cofilin-like 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_043995579.1.77316
Sequence length 168
Comment hypothetical protein [Microcystis aeruginosa]; AA=GCF_000312225.1; RF=na; TAX=1160283; STAX=1126; NAME=Microcystis aeruginosa PCC 9807; strain=PCC 9807; AL=Scaffold; RT=Major
Sequence
MVSQEKANLLKKENKMSISVVKLHPDCVAIFNEFKGNANKPTHDFLTMKLDGVNIVPDLC
PPIGTSSEDPRFGDKEHPAFDHMVSHLIEKGSGYAFYIFRYDKGNGHPSKLVFYTYVDDN
GPAKTKMAITSSKQVVEKGCPGFSLKIQANCKEDLSYKVGLDIVLERP
Download sequence
Identical sequences WP_043995579.1.77316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]