SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_044782870.1.92555 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_044782870.1.92555
Domain Number 1 Region: 150-181
Classification Level Classification E-value
Superfamily p53 tetramerization domain 0.0000432
Family p53 tetramerization domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_044782870.1.92555
Sequence length 243
Comment MULTISPECIES: phage protein [Bacillus cereus group]; AA=GCF_000948235.1; RF=na; TAX=1428; STAX=1428; NAME=Bacillus thuringiensis; strain=Lr7/2; AL=Contig; RT=Major
Sequence
MITIDKINSELYKAYDLFNHRFFEAKLPPAAITIQSSIHHKLAMGWCTTKEIWSDKEGKN
KLYEINISAEYIDYEFYETMDTLMHEMVHLYNKVHSIQDTSRNNTYHNKQFRESAIKSGF
MYEENKPDPDYGWSFAKLSQETKDIIDQMEIDQAIFTISRQGREHFEQIQEINDSMNLIE
SDLNDLINSHAASTPSLTEEKKKRKSYYRWTCPNTNCDLIVRTTKLDVNIKCGKCDKTLI
VDE
Download sequence
Identical sequences WP_044782870.1.3180 WP_044782870.1.92555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]