SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_046558582.1.54119 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_046558582.1.54119
Domain Number 1 Region: 12-92
Classification Level Classification E-value
Superfamily TIMP-like 0.00000249
Family Tissue inhibitor of metalloproteinases, TIMP 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_046558582.1.54119
Sequence length 114
Comment hypothetical protein [Arsukibacterium ikkense]; AA=GCF_000987775.1; RF=na; TAX=336831; STAX=336831; NAME=Arsukibacterium ikkense; strain=GCM72; AL=Contig; RT=Major
Sequence
MESDYVENVFIAFVKDAKAISSNGKYSRVVASFDIEKIFKRSEVMPTTVETYLDSAACGF
PIEVGSKYVFITDINGSVNYCTSRLIPKYSYDLEIERYLKDLEANMSKLEITKH
Download sequence
Identical sequences A0A0M2V5F2
WP_046558582.1.54119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]