SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_048101917.1.84084 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_048101917.1.84084
Domain Number 1 Region: 171-250
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 5.23e-22
Family eIF-2-alpha, C-terminal domain 0.0018
Further Details:      
 
Domain Number 2 Region: 5-85
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 7.08e-20
Family Cold shock DNA-binding domain-like 0.00073
Further Details:      
 
Domain Number 3 Region: 82-169
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 9.42e-18
Family eIF2alpha middle domain-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_048101917.1.84084
Sequence length 254
Comment MULTISPECIES: translation initiation factor IF-2 subunit alpha [Acidiplasma]; AA=GCF_001402945.1; RF=representative genome; TAX=507754; STAX=507754; NAME=Acidiplasma aeolicum; strain=VT; AL=Contig; RT=Major
Sequence
MPRDIPDTGDLVVVTVKEVKNYGAIVDLDEYPGVSGFVHITEVATGWIKHIKDYLRVNQR
TVCKVLNVDPSRNHVDLSLKRVNEHQKREKIEEWKNEQKAHKLLDMLFEEENINESKERE
DIEDLLLTEYGTLYSAFFEAASSKDFLKDKDLKWKDSLIKIAKENIAIPTVKIGGYLEMY
SLAPNGIETIKNVLTDDLIDDKDVQITYIGAPRYKITVIDEDYKSAEEKLKNVINVIETK
SKKNNVSFEFNREE
Download sequence
Identical sequences A0A0D8DK03 A0A0P9CMN2 A0A0Q0RS13
WP_048101917.1.23834 WP_048101917.1.69043 WP_048101917.1.83596 WP_048101917.1.84084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]