SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_048130147.1.44353 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_048130147.1.44353
Domain Number 1 Region: 6-98
Classification Level Classification E-value
Superfamily SRP19 1.83e-28
Family SRP19 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_048130147.1.44353
Sequence length 101
Comment MULTISPECIES: signal recognition particle protein Srp19 [Methanosarcina]; AA=GCF_000970005.1; RF=na; TAX=1434102; STAX=1434102; NAME=Methanosarcina sp. WH1; strain=WH1; AL=Complete Genome; RT=Major
Sequence
MKDRGKLVIWPAYIDQARSRSSGRIISRKNSIKDPHLNEIKEAAKQLGLNPEVEPEKAYP
KSWWEVSGRVLVDDKGPKSVIAKQISLSIKKMRSKEAPART
Download sequence
Identical sequences WP_048130147.1.35945 WP_048130147.1.44353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]