SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_048169888.1.11460 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_048169888.1.11460
Domain Number 1 Region: 83-172
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 1.7e-24
Family eIF2alpha middle domain-like 0.0019
Further Details:      
 
Domain Number 2 Region: 174-259
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 5.89e-23
Family eIF-2-alpha, C-terminal domain 0.0034
Further Details:      
 
Domain Number 3 Region: 8-95
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.93e-22
Family Cold shock DNA-binding domain-like 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_048169888.1.11460
Sequence length 268
Comment translation initiation factor IF-2 subunit alpha [Methanosarcina siciliae]; AA=GCF_000970145.1; RF=na; TAX=1434118; STAX=38027; NAME=Methanosarcina siciliae C2J; strain=C2J; AL=Complete Genome; RT=Major
Sequence
MGNDNWPEVGEFVVCTVKNVTDFGAYVELEEFGGREGFIHISEIKAGWVKYVRDYVREGQ
KIVCKVLNVDPSRGHIDLSLKDVNEHQRRAKIQEWKNEQKAAKWLQFVAEETKTDENGQQ
TLHEKLVEEFGSAYSAFEEAAIEGEKAFKGLKVNKKYLKSITKIAGENIKLPFVDIAGYV
DLTCNLPNGIEIIKQALHAADSISDVDGKDIRLEVSYTGAPRYRIKVIAPDYKKAESVLK
KSAQTAIDTISKLGGHGTFKRHIESAKA
Download sequence
Identical sequences A0A0E3L7S5 A0A0E3PAM3 A0A0E3PJG1
WP_048169888.1.11460 WP_048169888.1.43275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]