SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_048375898.1.100231 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_048375898.1.100231
Domain Number 1 Region: 28-182
Classification Level Classification E-value
Superfamily TIMP-like 5.18e-31
Family Tissue inhibitor of metalloproteinases, TIMP 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_048375898.1.100231
Sequence length 184
Comment cobalamin biosynthesis protein CbiN [Bacillus sp. LK2]; AA=GCF_001043575.1; RF=na; TAX=1628206; STAX=1628206; NAME=Bacillus sp. LK2; strain=LK2; AL=Contig; RT=Major
Sequence
MKRILHMLPVVVICSFILIIFPEKSYACDCIKKSPEDAFQKNDVVFEGKVVEVQRKEGVG
TEVLFEVKKIWKGTSSSQIIIYTNGGDCVFHFLEGGEYLVFSSQRGEEKQLYTHSCSGTK
RLDEAEMEKNVLSHIAKESVPSKKVNLKGDMANGLSWWKVAIISIGVLLIIAFVIFIVRK
VRKK
Download sequence
Identical sequences A0A0J6L0C1 A0A2C0CZD2
WP_048375898.1.100231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]