SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_049934842.1.3407 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_049934842.1.3407
Domain Number 1 Region: 80-179
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.27e-22
Family Cold shock DNA-binding domain-like 0.00012
Further Details:      
 
Domain Number 2 Region: 1-77
Classification Level Classification E-value
Superfamily N-terminal, heterodimerisation domain of RBP7 (RpoE) 3.27e-17
Family N-terminal, heterodimerisation domain of RBP7 (RpoE) 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_049934842.1.3407
Sequence length 190
Comment DNA-directed RNA polymerase [Haloplanus natans]; AA=GCF_000427685.1; RF=representative genome; TAX=926690; STAX=376171; NAME=Haloplanus natans DSM 17983; strain=DSM 17983; AL=Scaffold; RT=Major
Sequence
MYKRVRLKDTVEVPPRHLADVTPERVKRLLQDKLEGRMDEEVGSVVSVIEVHDIGDGAVL
PNRPGVYYEADFDAITFDPQMQEVVDGTVVEVVEFGAFVGIGPVDGLLHVSQISDEYLAY
DGENQQLASTQTNRTLGVGDEIRVRIVTKSVDERNPRDSKIGLTAKQPGLGKHGWLEEER
QKREAQMEGN
Download sequence
Identical sequences WP_049934842.1.3407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]