SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_050003517.1.1816 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_050003517.1.1816
Domain Number 1 Region: 3-190
Classification Level Classification E-value
Superfamily Archaeal IMP cyclohydrolase PurO 2.88e-59
Family Archaeal IMP cyclohydrolase PurO 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_050003517.1.1816
Sequence length 197
Comment IMP cyclohydrolase [Thermococcus eurythermalis]; AA=GCF_000769655.1; RF=representative genome; TAX=1505907; STAX=1505907; NAME=Thermococcus eurythermalis; strain=A501; AL=Complete Genome; RT=Major
Sequence
MTYTGRTLGIGLMKGKPFAFYLLCSRSFPRRRAIVRENAVYIENLTQTDNPYVSYPVVRL
LEDYAVVTNGLQTDFIAQTLEWESPKKALIHVLDALDYERDDYNTPRIAGIIGKDGRGWL
GFAGKDEFWVRELELKEGKAFVTATYNLGFTEIEFPQFNTAQELAEKTMELPFENKVLAI
GILRGKNWELGWKRASE
Download sequence
Identical sequences A0A097QVQ0
WP_050003517.1.1816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]