SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_050744195.1.37902 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_050744195.1.37902
Domain Number 1 Region: 42-83
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000291
Family Ovomucoid domain III-like 0.012
Further Details:      
 
Domain Number 2 Region: 137-177
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000036
Family Ovomucoid domain III-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_050744195.1.37902
Sequence length 180
Comment MULTISPECIES: hypothetical protein [Shinella]; AA=GCF_001267455.1; RF=na; TAX=1692240; STAX=1692240; NAME=Shinella sp. GWS1; strain=GWS1; AL=Scaffold; RT=Major
Sequence
MISLPFLSRLAGPAVLLLAAGTLAACSVEVDEGPGGYNPRPPQFCTREYAPVCGERGRDR
QTFANACEARSSGYGIIGRGECQFRRPDRDQTGWQDEDRDGWNNDGRDRDRDRNRNDRDR
RERDRNDRGDRERPRDQRACTMDYNPVCGRRGPDFKEFGNACSAEAAGFTVYRRGQCPIG
Download sequence
Identical sequences WP_050744195.1.102000 WP_050744195.1.37902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]