SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_051440453.1.36519 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_051440453.1.36519
Domain Number 1 Region: 28-69
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000291
Family Ovomucoid domain III-like 0.01
Further Details:      
 
Domain Number 2 Region: 79-118
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000222
Family Ovomucoid domain III-like 0.011
Further Details:      
 
Domain Number 3 Region: 126-166
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000751
Family Ovomucoid domain III-like 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_051440453.1.36519
Sequence length 167
Comment hypothetical protein [Ensifer aridi]; AA=GCF_002093525.1; RF=na; TAX=1708715; STAX=1708715; NAME=Ensifer aridi; strain=JNVU TP6; AL=Scaffold; RT=Major
Sequence
MTIGFLSACAVVVDEPRPGPGPVRPPGPQMCTMEYAPVCGERGNRMRTFPNACHARADGF
RVVHRGECRADFRPPAEQACTREFAPVCGERGARRQTFPNACVARAEGFRVVAPGECRRG
DDRPPPQFCTSEFAPVCGQRAGRLRTFPNACEARADGFSVVHPGECR
Download sequence
Identical sequences WP_051440453.1.36519 WP_051440453.1.39028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]