SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_054844912.1.15548 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_054844912.1.15548
Domain Number 1 Region: 34-123
Classification Level Classification E-value
Superfamily tRNA-intron endonuclease catalytic domain-like 0.00000000000000693
Family tRNA-intron endonuclease catalytic domain-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_054844912.1.15548
Sequence length 125
Comment hypothetical protein [Sulfolobus sp. JCM 16833]; AA=GCF_001316085.1; RF=na; TAX=1294262; STAX=1294262; NAME=Sulfolobus sp. JCM 16833; strain=JCM 16833; AL=Contig; RT=Major
Sequence
MSDHIENVKREEDIFQKLINRKEIRAEDISGINWDRLAVYVDLKQKGKVVCKGYDDSTLI
IKDRKIEGKSKAIILVINEAEKISPTKLLDVISRSKSLNLEVLVALVDKYGDITYYNISE
ARLIR
Download sequence
Identical sequences WP_054844912.1.15548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]